PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA8661
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family MYB
Protein Properties Length: 367aa    MW: 41752.5 Da    PI: 5.6252
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA8661genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.6e-171461148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  Tp57577_TGAC_v2_mRNA8661 14 KGLWSPEEDEKLLNHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                              678*******************************************97 PP

2Myb_DNA-binding45.71.5e-1467110146
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               rg +++eE+ ++++++  lG++ W+ Ia+ ++ gRt++++k+ w++
  Tp57577_TGAC_v2_mRNA8661  67 RGTFSQEEENIIIELHSVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                               899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.724961IPR017930Myb domain
SuperFamilySSF466891.34E-2912108IPR009057Homeodomain-like
SMARTSM007175.1E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001673.19E-111761No hitNo description
PROSITE profilePS5129425.67262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-2665116IPR009057Homeodomain-like
SMARTSM007174.3E-1366114IPR001005SANT/Myb domain
PfamPF002493.0E-1367111IPR001005SANT/Myb domain
CDDcd001677.96E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENIIIE LHSVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPVTHKPLS EVENVEQEEE KTKSQEKVTE ISESDELNLL RSESTSKSDA CSYEQKQSSI  180
VLKAYANEME VEGSCSNYLM GNYPIHMSYS SNDNLPNSNS SHWFNQTGSK TFDMNSEFSS  240
NIMSNTFCYK PSFDVPSEDV SISSASFPMK NSILSSWGLR DCDSSSKENQ SHIHMMENQT  300
EEEEEAKWNE YLQNPMLMLQ NQVPESLCNE IKPATNLSSD ALGDMLPHSK QQESSQSYNI  360
ATFGHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0528490.0BT052849.1 Medicago truncatula clone MTYFL_FM_FN_FO1G-P-4 unknown mRNA.
GenBankBT1474770.0BT147477.1 Medicago truncatula clone JCVI-FLMt-12D24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626082.10.0myb transcription factor MYB64
TrEMBLB7FL770.0B7FL77_MEDTR; Myb transcription factor MYB64
STRINGGLYMA02G00960.21e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.31e-88myb domain protein 55